Structure of PDB 3ebc Chain A Binding Site BS01

Receptor Information

>3ebc Chain A (length=241) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFIKPIYQDINSILIGQKVGEPFEKLVYKFLKENLSDLTFKQYEYLNDLF
MKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQNDTAD
ILLVKDQFYELLDVKTRNIAQAPAIISAYKLAQTCAKMIDNKEFDLFDIN
YLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQ
GFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYIL

Ligand information

>3ebc Chain E (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccggtcgacgggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ebc Early Interrogation and Recognition of DNA Sequence by Indirect Readout
Resolution	2.55 Å
Binding residue (original residue number in PDB)	R91 G92 K93 N110 Y199 N201 R241 K248
Binding residue (residue number reindexed from 1)	R77 G78 K79 N96 Y182 N184 R224 K231

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3ebc, PDBe:3ebc, PDBj:3ebc
PDBsum	3ebc
PubMed	19081059
UniProt	P17743\|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]