Structure of PDB 3e6y Chain A Binding Site BS01

Receptor Information
>3e6y Chain A (length=234) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVA
YKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICD
GILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAEST
LTAYKAAQDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQA
FDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e6y A structural rationale for selective stabilization of anti-tumor interactions of 14-3-3 proteins by cotylenin A
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R63 R136 Y137 L181 N182 V185 E189 N233 L236 W237
Binding residue
(residue number reindexed from 1)		R59 R132 Y133 L177 N178 V181 E185 N229 L232 W233
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007165 signal transduction
GO:0008104 protein localization
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3e6y, PDBe:3e6y, PDBj:3e6y
PDBsum3e6y
PubMed19244612
UniProtP93343|1433C_TOBAC 14-3-3-like protein C

[Back to BioLiP]