Structure of PDB 3e54 Chain A Binding Site BS01

Receptor Information
>3e54 Chain A (length=159) Species: 164451 (Vulcanisaeta distributa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEDFKEGYILGFIEAEGSFSVSIKFQRDVFGGVRLDPVFSITQKNREVLE
AIKEHLGIGRIMEKAGQPNTYVYVVDNFNELVKLINFLNKYADFMIVKKR
QFLMFREIANGLVNGEHLHINGLKRLVKLAYELTKESEKGYRKYDLNHVL
SIIDKWDLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e54 Recognition of a common rDNA target site in archaea and eukarya by analogous LAGLIDADG and His-Cys box homing endonucleases
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D31 V32 R37 R63 A68 N80 F81 H120 E141 K142 Y144
Binding residue
(residue number reindexed from 1)		D28 V29 R34 R60 A65 N77 F78 H117 E138 K139 Y141
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3e54, PDBe:3e54, PDBj:3e54
PDBsum3e54
PubMed18984620
UniProtQ6L703

[Back to BioLiP]