Structure of PDB 3e2u Chain A Binding Site BS01

Receptor Information
>3e2u Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGR
KYFTCDEGHGIFVRQSQIQVF
Ligand information
>3e2u Chain E (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPYCEICEMFGHWATNCNDDETF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e2u Structure-function relationship of CAP-Gly domains
Resolution2.6 Å
Binding residue
(original residue number in PDB)		F52 T54 G55 K56 W57 K68 N69 I87 F88 R90 Q91 S92 Q93
Binding residue
(residue number reindexed from 1)		F26 T28 G29 K30 W31 K42 N43 I61 F62 R64 Q65 S66 Q67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3e2u, PDBe:3e2u, PDBj:3e2u
PDBsum3e2u
PubMed17828277
UniProtQ14203|DCTN1_HUMAN Dynactin subunit 1 (Gene Name=DCTN1)

[Back to BioLiP]