Structure of PDB 3e2h Chain A Binding Site BS01

Receptor Information
>3e2h Chain A (length=175) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVP
WMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYG
CDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQA
GAAEYYRAYLEGECVEWLHRYLKNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e2h Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
Resolution3.8 Å
Binding residue
(original residue number in PDB)
Y7 I63 V66 Q70 W73 N77 T80 Y84 R97 Y99 T143 K146 W147 A150 A152 Y155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 I63 V66 Q70 W73 N77 T80 Y84 R97 Y99 T143 K146 W147 A150 A152 Y155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3e2h, PDBe:3e2h, PDBj:3e2h
PDBsum3e2h
PubMed18941216
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]