Structure of PDB 3e1r Chain A Binding Site BS01

Receptor Information
>3e1r Chain A (length=46) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e1r Midbody targeting of the ESCRT machinery by a noncanonical coiled coil in CEP55.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K180 Q183 W184 Y187 Q190 R191 V193 Y194
Binding residue
(residue number reindexed from 1)		K16 Q19 W20 Y23 Q26 R27 V29 Y30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000281 mitotic cytokinesis
GO:0051896 regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process
External links
PDB RCSB:3e1r, PDBe:3e1r, PDBj:3e1r
PDBsum3e1r
PubMed18948538
UniProtQ53EZ4|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]