Structure of PDB 3dzy Chain A Binding Site BS01

Receptor Information
>3dzy Chain A (length=302) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDK
RQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMP
VERILEAELAPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRA
GWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTEL
VSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAY
CKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLME
ML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dzy Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K145 H146 Y147 R164 Q206 E208 R209
Binding residue
(residue number reindexed from 1)		K14 H15 Y16 R33 Q75 E77 R78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001221 transcription coregulator binding
GO:0001972 retinoic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003707 nuclear steroid receptor activity
GO:0004879 nuclear receptor activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0019899 enzyme binding
GO:0042277 peptide binding
GO:0042802 identical protein binding
GO:0042809 nuclear vitamin D receptor binding
GO:0043565 sequence-specific DNA binding
GO:0044323 retinoic acid-responsive element binding
GO:0046872 metal ion binding
GO:0050692 DNA binding domain binding
GO:0050693 LBD domain binding
GO:0070644 vitamin D response element binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002157 positive regulation of thyroid hormone receptor signaling pathway
GO:0006355 regulation of DNA-templated transcription
GO:0009755 hormone-mediated signaling pathway
GO:0010875 positive regulation of cholesterol efflux
GO:0030154 cell differentiation
GO:0030501 positive regulation of bone mineralization
GO:0032411 positive regulation of transporter activity
GO:0032526 response to retinoic acid
GO:0035357 peroxisome proliferator activated receptor signaling pathway
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043401 steroid hormone receptor signaling pathway
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048384 retinoic acid receptor signaling pathway
GO:0070564 positive regulation of vitamin D receptor signaling pathway
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0043235 receptor complex
GO:0090575 RNA polymerase II transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dzy, PDBe:3dzy, PDBj:3dzy
PDBsum3dzy
PubMed19043829
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]