Structure of PDB 3dy0 Chain A Binding Site BS01

Receptor Information
>3dy0 Chain A (length=327) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDFTFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGL
GLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTF
VSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNA
VVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYL
LDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFK
KRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVS
EMVHKAVVEVDESGTRAAAATGTIFTF
Ligand information
>3dy0 Chain B (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SQRLVFNRPFLMFIVDNNILFLGKVNRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dy0 The heparin binding site of protein C inhibitor is protease-dependent.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		F31 Y34 S43 Q44 N45 I46 F47 F48 S49 P50 F204 Y205 V206 E220 Y225 A244 T245 A246 L247 F248 I249 L250 P251 M256 E260 L268 R278 Q279 L280 E281 L282 Y283 P285 F287 A343 A344
Binding residue
(residue number reindexed from 1)		F5 Y8 S17 Q18 N19 I20 F21 F22 S23 P24 F178 Y179 V180 E194 Y199 A218 T219 A220 L221 F222 I223 L224 P225 M230 E234 L242 R252 Q253 L254 E255 L256 Y257 P259 F261 A317 A318
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Cellular Component
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3dy0, PDBe:3dy0, PDBj:3dy0
PDBsum3dy0
PubMed18974053
UniProtP05154|IPSP_HUMAN Plasma serine protease inhibitor (Gene Name=SERPINA5)

[Back to BioLiP]