Structure of PDB 3dvu Chain A Binding Site BS01

Receptor Information
>3dvu Chain A (length=130) Species: 33708 (Murid gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDS
VYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLC
PGSWTEDHELLNDCMTHFFIENNLMNHFPL
Ligand information
>3dvu Chain C (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGTMENLSRRLKVTGDLFDIMSGQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dvu Molecular basis of the regulation of Beclin 1-dependent autophagy by the gamma-herpesvirus 68 Bcl-2 homolog M11.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F48 H51 Y52 Y56 A63 L74 S77 L78 N84 G86 R87
Binding residue
(residue number reindexed from 1)		F44 H47 Y48 Y52 A59 L70 S73 L74 N80 G82 R83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3dvu, PDBe:3dvu, PDBj:3dvu
PDBsum3dvu
PubMed18797192
UniProtP89884|ARBH_MHV68 Apoptosis regulator Bcl-2 homolog (Gene Name=vBCL2)

[Back to BioLiP]