Structure of PDB 3dtx Chain A Binding Site BS01

Receptor Information
>3dtx Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dtx Citrullination-and mhc polymorphism-dependent conformational changes of a self peptide
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y7 H9 T24 E45 R62 E63 I66 C67 T73 D77 L81 Y84 Y99 T143 K146 W147 V152 L156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 H9 T24 E45 R62 E63 I66 C67 T73 D77 L81 Y84 Y99 T143 K146 W147 V152 L156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
Cellular Component
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dtx, PDBe:3dtx, PDBj:3dtx
PDBsum3dtx
PubMed
UniProtA3F718

[Back to BioLiP]