Structure of PDB 3dqb Chain A Binding Site BS01

Receptor Information
>3dqb Chain A (length=326) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML
GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH
GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE
NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN
ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV
TRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dqb Crystal structure of opsin in its G-protein-interacting conformation
Resolution3.2 Å
Binding residue
(original residue number in PDB)		L72 R135 V138 V139 T242 A246 N310
Binding residue
(residue number reindexed from 1)		L72 R135 V138 V139 T242 A246 N310
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0002046 opsin binding
GO:0004930 G protein-coupled receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005502 11-cis retinal binding
GO:0005515 protein binding
GO:0008020 G protein-coupled photoreceptor activity
GO:0008270 zinc ion binding
GO:0009881 photoreceptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007601 visual perception
GO:0007602 phototransduction
GO:0007603 phototransduction, visible light
GO:0009416 response to light stimulus
GO:0009583 detection of light stimulus
GO:0009642 response to light intensity
GO:0010467 gene expression
GO:0016038 absorption of visible light
GO:0016056 G protein-coupled opsin signaling pathway
GO:0043052 thermotaxis
GO:0045494 photoreceptor cell maintenance
GO:0050953 sensory perception of light stimulus
GO:0050960 detection of temperature stimulus involved in thermoception
GO:0060041 retina development in camera-type eye
GO:0071482 cellular response to light stimulus
GO:0071800 podosome assembly
GO:1904389 rod bipolar cell differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0001750 photoreceptor outer segment
GO:0001917 photoreceptor inner segment
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0016020 membrane
GO:0019867 outer membrane
GO:0042622 photoreceptor outer segment membrane
GO:0042995 cell projection
GO:0060342 photoreceptor inner segment membrane
GO:0097225 sperm midpiece
GO:0097381 photoreceptor disc membrane
GO:0097648 G protein-coupled receptor complex
GO:0120200 rod photoreceptor outer segment
GO:1990913 sperm head plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dqb, PDBe:3dqb, PDBj:3dqb
PDBsum3dqb
PubMed18818650
UniProtP02699|OPSD_BOVIN Rhodopsin (Gene Name=RHO)

[Back to BioLiP]