Structure of PDB 3do7 Chain A Binding Site BS01

Receptor Information

>3do7 Chain A (length=296) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTE
ASKTQPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCR
VRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQ
EVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRIN
KESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAI
VFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSY

Ligand information

>3do7 Chain C (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggaattcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3do7 NF-kapppaB p52:RelB heterodimer uses different binding modes to recognize different kappaB DNA
Resolution	3.05 Å
Binding residue (original residue number in PDB)	Y120 C122 E123 R209 K210 T276 K308 Q334
Binding residue (residue number reindexed from 1)	Y33 C35 E36 R122 K123 T189 K221 Q247

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3do7, PDBe:3do7, PDBj:3do7
PDBsum	3do7
PubMed
UniProt	Q04863\|RELB_MOUSE Transcription factor RelB (Gene Name=Relb)

[Back to BioLiP]