Structure of PDB 3dnj Chain A Binding Site BS01

Receptor Information
>3dnj Chain A (length=80) Species: 155892 (Caulobacter vibrioides) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVY
TYEVAETKVAQVIDSARRHQHPLQCTMEKD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dnj The molecular basis of N-end rule recognition.
Resolution1.15 Å
Binding residue
(original residue number in PDB)		L46 N47 D48 T51 P52 M53 V56 V78 H79 L112
Binding residue
(residue number reindexed from 1)		L7 N8 D9 T12 P13 M14 V17 V39 H40 L73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006508 proteolysis
GO:0030163 protein catabolic process

View graph for
Biological Process
External links
PDB RCSB:3dnj, PDBe:3dnj, PDBj:3dnj
PDBsum3dnj
PubMed18995838
UniProtQ9A5I0|CLPS_CAUVC ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]