Structure of PDB 3dep Chain A Binding Site BS01

Receptor Information
>3dep Chain A (length=183) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWT
AARKADEQALSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGA
DLDHRDMRGGLTALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELA
REILKTTPKGNPMQFGRRIGLEKVINVLEGQVF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dep Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R161 L170 M200 G203 Y204 R226 T240
Binding residue
(residue number reindexed from 1)
R77 L86 M116 G119 Y120 R142 T156
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3dep, PDBe:3dep, PDBj:3dep
PDBsum3dep
PubMed18621669
UniProtO22265|SR43C_ARATH Signal recognition particle 43 kDa protein, chloroplastic (Gene Name=CAO)

[Back to BioLiP]