Structure of PDB 3dac Chain A Binding Site BS01

Receptor Information
>3dac Chain A (length=85) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIV
HCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dac Structure of the human Mdmx protein bound to the p53 tumor suppressor transactivation domain.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		M59 Q61
Binding residue
(residue number reindexed from 1)		M38 Q40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dac, PDBe:3dac, PDBj:3dac
PDBsum3dac
PubMed18677113
UniProtQ7ZUW7|MDM4_DANRE Protein Mdm4 (Gene Name=mdm4)

[Back to BioLiP]