Structure of PDB 3d9k Chain A Binding Site BS01

Receptor Information
>3d9k Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFI
QKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYR
CPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d9k Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
I21 K23 M26 Y64 D67 S68 R71 L116
Binding residue
(residue number reindexed from 1)
I20 K22 M25 Y63 D66 S67 R70 L115
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3d9k, PDBe:3d9k, PDBj:3d9k
PDBsum3d9k
PubMed18550522
UniProtQ9UPN6|SCAF8_HUMAN SR-related and CTD-associated factor 8 (Gene Name=SCAF8)

[Back to BioLiP]