Structure of PDB 3d6z Chain A Binding Site BS01

Receptor Information

>3d6z Chain A (length=277) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLI
HLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSAL
EQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNAS
YSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQIS
SITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDV
YELIIPIHYSPKKQEEYRVEMKIEILD

Ligand information

>3d6z Chain B (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgaccctccccttaggggagggtc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3d6z Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
Resolution	2.6 Å
Binding residue (original residue number in PDB)	S7 I8 G9 R23 Y42 R43
Binding residue (residue number reindexed from 1)	S6 I7 G8 R22 Y41 R42
Binding affinity	PDBbind-CN: Kd=0.96uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3d6z, PDBe:3d6z, PDBj:3d6z
PDBsum	3d6z
PubMed	18658145
UniProt	P39075\|BMRR_BACSU Multidrug-efflux transporter 1 regulator (Gene Name=bmrR)

[Back to BioLiP]