Structure of PDB 3d3t Chain A Binding Site BS01

Receptor Information
>3d3t Chain A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWQRPLVTIKIGGQLREALLNTGADDTVLEDINLPGKWKPKMIGGI
GGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF
Ligand information
>3d3t Chain P (length=8) Species: 11683 (Human immunodeficiency virus type 1 (Z2/CDC-Z34 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GNFLQSRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d3t Structural analysis of human immunodeficiency virus type 1 CRF01_AE protease in complex with the substrate p1-p6.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G27 A28 D29 D30 I47 G48 G49 I50 V82
Binding residue
(residue number reindexed from 1)		G27 A28 D29 D30 I47 G48 G49 I50 V82
Enzymatic activity
Catalytic site (original residue number in PDB) N25 T26 G27
Catalytic site (residue number reindexed from 1) N25 T26 G27
Enzyme Commision number 3.1.13.2: exoribonuclease H.
3.1.26.13: retroviral ribonuclease H.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3d3t, PDBe:3d3t, PDBj:3d3t
PDBsum3d3t
PubMed18434392
UniProtQ90VT5

[Back to BioLiP]