Structure of PDB 3d2w Chain A Binding Site BS01

Receptor Information
>3d2w Chain A (length=72) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKV
AQSLCGEDLIIKGISVHISNAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d2w Structural insights into TDP-43 in nucleic-acid binding and domain interactions
Resolution1.65 Å
Binding residue
(original residue number in PDB)		K192 F194 R197 F221 R227 F229 F231 S258 E261
Binding residue
(residue number reindexed from 1)		K3 F5 R8 F32 R38 F40 F42 S69 E72
Binding affinityPDBbind-CN: Kd=137.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3d2w, PDBe:3d2w, PDBj:3d2w
PDBsum3d2w
PubMed19174564
UniProtQ921F2|TADBP_MOUSE TAR DNA-binding protein 43 (Gene Name=Tardbp)

[Back to BioLiP]