Structure of PDB 3d2u Chain A Binding Site BS01

Receptor Information

>3d2u Chain A (length=281) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HVLRYGYTGIFDDTSHMTLTVVGIFDGQHFFTYHVQSSDKASSRANGTIS
WMANVSAAYPTYLDGERAKGDLIFNQTEQNLLELEIALGYRSQSVLTWTH
ECNTTENGSFVAGYEGFGWDGETLMELKDNLTLWTGPNYEISWLKQQKTY
IDGKIKNISEGDTTIQRNYLKGNCTQWSVIYSGFQPPVTHPVVKGGVRNQ
NDNRAEAFCTSYGFFPGEIQITFIHYGDKVPEDSEPQCNPLLPTLDGTFH
QGCYVAIFSNQNYTCRVTHGNWTVEIPISVT

Ligand information

>3d2u Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ALPHAILRL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3d2u Structure of UL18, a peptide-binding viral MHC mimic, bound to a host inhibitory receptor
Resolution	2.21 Å
Binding residue (original residue number in PDB)	Y5 Y7 E66 K69 I73 Q76 N80 H100 W134 D162 Y169 W177 Y181
Binding residue (residue number reindexed from 1)	Y5 Y7 E66 K69 I73 Q76 N80 H100 W134 D162 Y169 W177 Y181

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3d2u, PDBe:3d2u, PDBj:3d2u
PDBsum	3d2u
PubMed	18632577
UniProt	P08560\|UL18_HCMVA Glycoprotein UL18 (Gene Name=H301)

[Back to BioLiP]