Structure of PDB 3cvq Chain A Binding Site BS01

Receptor Information
>3cvq Chain A (length=289) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREE
AWRSLGLTQAENEKDGLAIIALNHARALDPADIAVHAALAVSHTNEHNAN
AALASLRAWLLSQPQYEQLGSVNEDFFFAAPNEYRECRTLLHAALEMNPN
DAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGN
RPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQ
VATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cvq Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		V425 N429 N538 K539 A542 N546 R569 Y572 N573 V576 N580 F619 M622
Binding residue
(residue number reindexed from 1)		V91 N95 N190 K191 A194 N198 R221 Y224 N225 V228 N232 F259 M262
Enzymatic activity
Enzyme Commision number ?
External links