Structure of PDB 3cvp Chain A Binding Site BS01

Receptor Information
>3cvp Chain A (length=279) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEA
WRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANA
ALASLRAWLLSQPQYEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASL
GVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDA
YNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVTRSMWDF
FRMLLNVMNRPDLVELTYAQNVEPFAKEF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cvp Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E397 V425 N429 N511 N538 K539 A542 A545 N546 R569 N573 V576 N580
Binding residue
(residue number reindexed from 1)		E62 V90 N94 N155 N182 K183 A186 A189 N190 R213 N217 V220 N224
Enzymatic activity
Enzyme Commision number ?
External links