Structure of PDB 3cun Chain A Binding Site BS01

Receptor Information
>3cun Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>3cun Chain C (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggauggcgaaagccauuuccgcaggccccauugcacuccgggguauuggc
guuagguggugguacgagguucgaauccucguaccgcagcca
<<<<<<<....>>>>>>.><<<..<<<<<..........>>>>>....>>
>...<<<.<<<<<<<<<<<.......>>>>>>>>>>>.>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cun Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y308 N310 N311 E314 L339 S343 L344 K345 M346 R347 Q349 F351 R378 Q380 Y381 A382 K383 S386 D387
Binding residue
(residue number reindexed from 1)		Y7 N9 N10 E13 L38 S42 L43 K44 M45 R46 Q48 F50 R77 Q79 Y80 A81 K82 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3cun, PDBe:3cun, PDBj:3cun
PDBsum3cun
PubMed18548004
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]