Structure of PDB 3crf Chain A Binding Site BS01

Receptor Information
>3crf Chain A (length=123) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTG
TAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVL
TGPAQNVTADTYPITLDVVGYQP
Ligand information
>3crf Chain C (length=19) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSFLPNSEQQKSVDIVFSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3crf Structural analysis of the Saf pilus by electron microscopy and image processing.
Resolution17.0 Å
Binding residue
(original residue number in PDB)		A35 G36 K37
Binding residue
(residue number reindexed from 1)		A14 G15 K16
Enzymatic activity
Enzyme Commision number ?
External links