Structure of PDB 3ch8 Chain A Binding Site BS01

Receptor Information

>3ch8 Chain A (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQA
NGYSFINIEHGQAVSLLKTFQNTVELIIVREGAKQEIRVRVEKDGGSGGV
SSVPTNLEVVAATPTSLLISWDAYRELPVSYYRITYGETGGNSPVQEFTV
PGSKSTATISGLKPGVDYTITVYAHYNYHYYSSPISINYR

Ligand information

>3ch8 Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PQPVDSWV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ch8 Structural basis for exquisite specificity of affinity clamps, synthetic binding proteins generated through directed domain-interface evolution.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	E3 L4 G5 F6 S7 I8 S9 R15 R30 H60 V103 R136 Y181 H182 Y183 Y184 S185
Binding residue (residue number reindexed from 1)	E3 L4 G5 F6 S7 I8 S9 R15 R30 H60 V100 R133 Y178 H179 Y180 Y181 S182

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3ch8, PDBe:3ch8, PDBj:3ch8
PDBsum	3ch8
PubMed	19646997
UniProt	Q96RT1\|ERBIN_HUMAN Erbin (Gene Name=ERBIN)

[Back to BioLiP]