Structure of PDB 3ch1 Chain A Binding Site BS01

Receptor Information
>3ch1 Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNLLRTDSPKAHVTHHPRSKGEVTLR
CWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLG
KEQNYTCRVYHEGLPEPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ch1 Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y7 R62 E63 K66 Q70 W73 V76 S77 Y84 L95 Q97 S99 T143 K146 W147 S150 G151 A152 H155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 R62 E63 K66 Q70 W73 V76 S77 Y84 L95 Q97 S99 T143 K146 W147 S150 G151 A152 H155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ch1, PDBe:3ch1, PDBj:3ch1
PDBsum3ch1
PubMed19789338
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]