Structure of PDB 3cb8 Chain A Binding Site BS01

Receptor Information
>3cb8 Chain A (length=244) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVT
VEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHT
CLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLE
FAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPY
HELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cb8 Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		V15 D16 F25 H37 N38 L204 K208
Binding residue
(residue number reindexed from 1)		V14 D15 F24 H36 N37 L203 K207
Enzymatic activity
Enzyme Commision number 1.97.1.4: [formate-C-acetyltransferase]-activating enzyme.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0030955 potassium ion binding
GO:0043365 [formate-C-acetyltransferase]-activating enzyme activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006006 glucose metabolic process
GO:0006974 DNA damage response
GO:0051604 protein maturation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cb8, PDBe:3cb8, PDBj:3cb8
PDBsum3cb8
PubMed18852451
UniProtP0A9N4|PFLA_ECOLI Pyruvate formate-lyase 1-activating enzyme (Gene Name=pflA)

[Back to BioLiP]