Structure of PDB 3c6w Chain A Binding Site BS01

Receptor Information
>3c6w Chain A (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQ
E
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c6w The crystal structure of the ING5 PHD finger in complex with an H3K4me3 histone peptide.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		Y188 S195 Y196 G197 E198 M199 I200 G201 C202 D203 W211 F214 P223 G225
Binding residue
(residue number reindexed from 1)		Y4 S11 Y12 G13 E14 M15 I16 G17 C18 D19 W27 F30 P39 G41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3c6w, PDBe:3c6w, PDBj:3c6w
PDBsum3c6w
PubMed18623064
UniProtQ8WYH8|ING5_HUMAN Inhibitor of growth protein 5 (Gene Name=ING5)

[Back to BioLiP]