Structure of PDB 3c59 Chain A Binding Site BS01

Receptor Information
>3c59 Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPG
SFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE
SKR
Ligand information
>3c59 Chain B (length=27) Species: 8554 (Heloderma suspectum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLSKQMEEEAVRMFIEWLKNGGPSSGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c59 Crystal Structure of the Ligand-bound Glucagon-like Peptide-1 Receptor Extracellular Domain
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V30 S31 L32 W39 E68 Y69 Y88 R121 E128
Binding residue
(residue number reindexed from 1)		V2 S3 L4 W11 E40 Y41 Y60 R93 E100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0008528 G protein-coupled peptide receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3c59, PDBe:3c59, PDBj:3c59
PDBsum3c59
PubMed18287102
UniProtP43220|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]