Structure of PDB 3c1c Chain A Binding Site BS01

Receptor Information
>3c1c Chain A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>3c1c Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c1c The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
Resolution3.15 Å
Binding residue
(original residue number in PDB)
R440 R442 P443 T445 R463 R472 R483 R516 V517 T518
Binding residue
(residue number reindexed from 1)
R3 R5 P6 T8 R26 R35 R46 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3c1c, PDBe:3c1c, PDBj:3c1c
PDBsum3c1c
PubMed18794842
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]