Structure of PDB 3bxn Chain A Binding Site BS01

Receptor Information
>3bxn Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQWMYG
CDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
REAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bxn Structural basis for T cell alloreactivity among three HLA-B14 and HLA-B27 antigens
Resolution1.864 Å
Binding residue
(original residue number in PDB)		Y7 Y9 S24 E45 Y59 N63 I66 C67 N70 E76 S77 Y84 W97 Y99 F116 Y123 T143 K146 W147 E152 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 Y9 S24 E45 Y59 N63 I66 C67 N70 E76 S77 Y84 W97 Y99 F116 Y123 T143 K146 W147 E152 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links