Structure of PDB 3bu8 Chain A Binding Site BS01

Receptor Information
>3bu8 Chain A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGK
EHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEF
TLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRN
DLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKA
LKSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bu8 A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		R80 Q84 L87 R102 Q105 S108 R109 L116 D117 S119 F120 D121 A124 E125 L126 N168 E170 K173
Binding residue
(residue number reindexed from 1)		R37 Q41 L44 R59 Q62 S65 R66 L73 D74 S76 F77 D78 A81 E82 L83 N125 E127 K130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bu8, PDBe:3bu8, PDBj:3bu8
PDBsum3bu8
PubMed18202258
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]