Structure of PDB 3bu6 Chain A Binding Site BS01

Receptor Information

>3bu6 Chain A (length=297) Species: 9606 (Homo sapiens)

DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESA
SLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKS
YLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAAR
NCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVF
TTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPE
RVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

Ligand information

>3bu6 Chain B (length=14) Species: 10090 (Mus musculus)

YNPYPEDYGDIEIG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3bu6 Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
• Resolution: 1.95 Å
• Binding residue (original residue number in PDB): M1079 D1083 K1085 S1086 D1132 R1136 N1137 K1165 G1166 G1167 K1168 G1169 L1170 L1171 P1172 W1175 S1180 L1181 K1182 G1184 Q1208 N1215
• Binding residue (residue number reindexed from 1): M93 D97 K99 S100 D146 R150 N151 K179 G180 G181 K182 G183 L184 L185 P186 W189 S194 L195 K196 G198 Q222 N229

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171
• Catalytic site (residue number reindexed from 1): D146 A148 R150 N151 D164 E173 L185
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3bu6, PDBe:3bu6, PDBj:3bu6
• PDBsum: 3bu6
• PubMed: 18278056
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)