Structure of PDB 3bu5 Chain A Binding Site BS01

Receptor Information

>3bu5 Chain A (length=294) Species: 9606 (Homo sapiens)

DEWEVSREKITLLRELGQGMVYEGNARDIIKGEAETRVAVKTVNESASLR
ERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLR
SLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCM
VAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTS
SDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVT
DLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

Ligand information

>3bu5 Chain B (length=12) Species: 10090 (Mus musculus)

PYPEDYGDIEIG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3bu5 Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): K1085 S1086 D1132 R1136 K1165 G1166 G1167 K1168 G1169 L1170 L1171 P1172 W1175 S1180 L1181 K1182 G1184 F1186 Q1208
• Binding residue (residue number reindexed from 1): K96 S97 D143 R147 K176 G177 G178 K179 G180 L181 L182 P183 W186 S191 L192 K193 G195 F197 Q219

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171
• Catalytic site (residue number reindexed from 1): D143 A145 R147 N148 D161 E170 L182
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3bu5, PDBe:3bu5, PDBj:3bu5
• PDBsum: 3bu5
• PubMed: 18278056
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)