Structure of PDB 3bs4 Chain A Binding Site BS01

Receptor Information
>3bs4 Chain A (length=245) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLSWEIEELDREIGKIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNL
VGMFSISYPLQLIIRILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVW
YLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEV
FTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRR
ADYVLKTRSSLGENGIKRELLVIKTPKVRFEYEFKGNEPKLRREG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bs4 Crystal structure of uncharacterized protein PH0321 from Pyrococcus horikoshii in complex with an unknown peptide.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		G52 F54 H125 K126 W129 M147 Y150 Y162 R170 Y176 G182 N184 W186
Binding residue
(residue number reindexed from 1)		G52 F54 H122 K123 W126 M144 Y147 Y159 R167 Y173 G179 N181 W183
Enzymatic activity
Enzyme Commision number ?
External links