Structure of PDB 3bqo Chain A Binding Site BS01

Receptor Information
>3bqo Chain A (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHG
LSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSI
EKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFHMPFKSKLLM
IISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVES
KR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bqo A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R102 E106 H110 C126 Q127 T130 R131 L138 D139 Q141 F142 N144 E146 T149 E192
Binding residue
(residue number reindexed from 1)		R41 E45 H49 C65 Q66 T69 R70 L77 D78 Q80 F81 N83 E85 T88 E131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:3bqo, PDBe:3bqo, PDBj:3bqo
PDBsum3bqo
PubMed18202258
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]