Structure of PDB 3bpm Chain A Binding Site BS01

Receptor Information

>3bpm Chain A (length=243) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YEANYEDVIKKYKPADAKLDRIAYDWRLHGGVTPVKDQALCGSCWAFSSV
GSVESQYAIRKKALFLFSEQELVDCSVKNNGCYGGYITNAFDDMIDLGGL
CSQDDYPYVSNLPETCNLKRCNERYTIKSYVSIPDDKFKEALRYLGPISI
SIAASDDFAFYRGGFYDGECGAAPNHAVILVGYGMKDIYNEDTGRMEKFY
YYIIKNSWGSDWGEGGYINLETDENGYKKTCSIGTEAYVPLLE

Ligand information

>3bpm Chain D (length=3) Species: 66430 (Streptomyces roseus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3bpm Structures of falcipain-2 and falcipain-3 bound to small molecule inhibitors: implications for substrate specificity.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	G49 C51 G91 G92 Y93 N182 H183
Binding residue (residue number reindexed from 1)	G42 C44 G84 G85 Y86 N175 H176

Enzymatic activity

Catalytic site (original residue number in PDB)	Q45 C51 H183 N213
Catalytic site (residue number reindexed from 1)	Q38 C44 H176 N206
Enzyme Commision number	3.4.22.-

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3bpm, PDBe:3bpm, PDBj:3bpm
PDBsum	3bpm
PubMed	19128015
UniProt	Q8IIL0\|FPC3_PLAF7 Falcipain-3 (Gene Name=FP3)

[Back to BioLiP]