Structure of PDB 3bl2 Chain A Binding Site BS01

Receptor Information
>3bl2 Chain A (length=131) Species: 33708 (Murid gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDS
VYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLC
PGSWTEDHELLNDCMTHFFIENNLMNHFPLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bl2 Structural and Biochemical Bases for the Inhibition of Autophagy and Apoptosis by Viral BCL-2 of Murine gamma-Herpesvirus 68
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F48 H51 Y52 Y56 Y60 A63 K73 L74 S77 L78 N84 G86 R87
Binding residue
(residue number reindexed from 1)		F44 H47 Y48 Y52 Y56 A59 K69 L70 S73 L74 N80 G82 R83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3bl2, PDBe:3bl2, PDBj:3bl2
PDBsum3bl2
PubMed18248095
UniProtP89884|ARBH_MHV68 Apoptosis regulator Bcl-2 homolog (Gene Name=vBCL2)

[Back to BioLiP]