Structure of PDB 3bfw Chain A Binding Site BS01

Receptor Information
>3bfw Chain A (length=132) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVT
ASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQS
AHFPLQVRALTVNGGATQGTIQAVISITYTYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bfw Infinite Kinetic Stability against Dissociation of Supramolecular Protein Complexes through Donor Strand Complementation
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V18 T20 T21 A23 T24 V25 D26 L27 G28 D29 L30 Y31 S32 T129 Q130 G131 T132 I133 Q134 A135 V136 I137 S138 I139 T140 Y141
Binding residue
(residue number reindexed from 1)		V6 T8 T9 A11 T12 V13 D14 L15 G16 D17 L18 Y19 S20 T117 Q118 G119 T120 I121 Q122 A123 V124 I125 S126 I127 T128 Y129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007155 cell adhesion
GO:0007638 mechanosensory behavior
GO:0031589 cell-substrate adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0009289 pilus
GO:0009419 pilus tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bfw, PDBe:3bfw, PDBj:3bfw
PDBsum3bfw
PubMed18400183
UniProtP08190|FIMG_ECOLI Protein FimG (Gene Name=fimG)

[Back to BioLiP]