Structure of PDB 3bev Chain A Binding Site BS01

Receptor Information
>3bev Chain A (length=274) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWI
AANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCD
ILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYA
EGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDG
DKYQCRVEHASLPQPGLYSWRSGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bev Structures of an MHC class I molecule from b21 chickens illustrate promiscuous Peptide binding
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y7 R9 D24 M34 R61 E62 I65 V66 G68 S69 I72 N76 I79 W95 H111 F120 T140 K143 W144 Y149 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y7 R9 D24 M34 R61 E62 I65 V66 G68 S69 I72 N76 I79 W95 H111 F120 T140 K143 W144 Y149 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links