Structure of PDB 3b7v Chain A Binding Site BS01

Receptor Information
>3b7v Chain A (length=99) Species: 11678 (Human immunodeficiency virus type 1 BH10) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI
GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
Ligand information
>3b7v Chain C (length=5) Species: 11678 (Human immunodeficiency virus type 1 BH10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NLTQI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3b7v Caught in the Act: The 1.5 A Resolution Crystal Structures of the HIV-1 Protease and the I54V Mutant Reveal a Tetrahedral Reaction Intermediate.
Resolution1.46 Å
Binding residue
(original residue number in PDB)		R8 D25 G27 A28 D29 D30 I47 G48 G49
Binding residue
(residue number reindexed from 1)		R8 D25 G27 A28 D29 D30 I47 G48 G49
Enzymatic activity
Enzyme Commision number 3.4.23.16: HIV-1 retropepsin.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
GO:0042802 identical protein binding
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3b7v, PDBe:3b7v, PDBj:3b7v
PDBsum3b7v
PubMed18052235
UniProtQ7SSI0

[Back to BioLiP]