Structure of PDB 3b1k Chain A Binding Site BS01

Receptor Information
>3b1k Chain A (length=338) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYD
SVLGRFNADISYDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTG
VFVTAEGASKHIQAGAKKVLITAPGKGEGVGTYVIGVNDSEYRHEDFAVI
SNASCTTNCLAPVAKVLHDNFGIIKGTMTTTHSYTLDQRILDASHRDLRR
ARAAAVNIVPTTTGAAKAVALVIPELKGKLNGIALRVPTPNVSVVDLVVQ
VEKPTITEQVNEVLQKASQTTMKGIIKYSDLPLVSSDFRGTDESSIVDSS
LTLVMDGDLVKVIAWYDNEWGYSQRVVDLAELAARKWA
Ligand information
>3b1k Chain C (length=22) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPFFGDYCSENPDAAECLIYDD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3b1k Structure Basis for the Regulation of Glyceraldehyde-3-Phosphate Dehydrogenase Activity via the Intrinsically Disordered Protein CP12.
Resolution3.302 Å
Binding residue
(original residue number in PDB)
R80 T156 T185 L186 D187 S194 H195 R196 T213 G214 A215 R236
Binding residue
(residue number reindexed from 1)
R80 T156 T185 L186 D187 S194 H195 R196 T213 G214 A215 R236
Enzymatic activity
Catalytic site (original residue number in PDB) C155 H182
Catalytic site (residue number reindexed from 1) C155 H182
Enzyme Commision number 1.2.1.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0046872 metal ion binding
GO:0050661 NADP binding
GO:0051287 NAD binding
Biological Process
GO:0006006 glucose metabolic process

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3b1k, PDBe:3b1k, PDBj:3b1k
PDBsum3b1k
PubMed22153507
UniProtQ9R6W2

[Back to BioLiP]