Structure of PDB 3av1 Chain A Binding Site BS01

Receptor Information
>3av1 Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>3av1 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3av1 Structures of human nucleosomes containing major histone H3 variants
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R42 P43 T45 R63 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		R4 P5 T7 R25 R34 R45 F46 Q47 R78 V79 T80 M82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3av1, PDBe:3av1, PDBj:3av1
PDBsum3av1
PubMed21636898
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]