Structure of PDB 3at0 Chain A Binding Site BS01

Receptor Information

>3at0 Chain A (length=317) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKL
PDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTD
YVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSS
PIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIK
GYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQ
FKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDP
VTNRDYSIFGWNNENVV

Ligand information

>3at0 Chain B (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WNSGSSGTGSTG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3at0 Structural and biochemical characterization of ClfB:ligand interactions
Resolution	2.5 Å
Binding residue (original residue number in PDB)	N234 Q235 S236 G237 N238 N268 D270 V271 Y273 M280 P281 P326 F328 Q377 Q503 G521 W522 N523 N524 N526
Binding residue (residue number reindexed from 1)	N23 Q24 S25 G26 N27 N57 D59 V60 Y62 M69 P70 P115 F117 Q166 Q292 G310 W311 N312 N313 N315

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0007155	cell adhesion

	Cellular Component
GO:0005618	cell wall

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3at0, PDBe:3at0, PDBj:3at0
PDBsum	3at0
PubMed
UniProt	Q7A382\|CLFB_STAAN Clumping factor B (Gene Name=clfB)

[Back to BioLiP]