Structure of PDB 3asl Chain A Binding Site BS01

Receptor Information
>3asl Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPP
LSSVPSEDEWYCPECRND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3asl Recognition of modification status on a histone H3 tail by linked histone reader modules of the epigenetic regulator UHRF1
Resolution1.41 Å
Binding residue
(original residue number in PDB)		C316 P327 D328 Q330 L331 M332 C333 D334 D337 V352 P353 E355
Binding residue
(residue number reindexed from 1)		C18 P29 D30 Q32 L33 M34 C35 D36 D39 V54 P55 E57
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3asl, PDBe:3asl, PDBj:3asl
PDBsum3asl
PubMed22837395
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]