Structure of PDB 3agy Chain A Binding Site BS01

Receptor Information
>3agy Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKE
GTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLRE
ALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDL
IIEFEVIFPERIPQTSRTVLEQVLPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3agy Peptide-binding sites as revealed by the crystal structures of the human Hsp40 Hdj1 C-terminal domain in complex with the octapeptide from human Hsp70
Resolution1.85 Å
Binding residue
(original residue number in PDB)
H166 K181 K182 M183 K184 I185 S186 D225 F237
Binding residue
(residue number reindexed from 1)
H2 K17 K18 M19 K20 I21 S22 D61 F73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3agy, PDBe:3agy, PDBj:3agy
PDBsum3agy
PubMed20809635
UniProtP25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 (Gene Name=DNAJB1)

[Back to BioLiP]