Structure of PDB 3agv Chain A Binding Site BS01

Receptor Information
>3agv Chain A (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLFPPKPKDTLMISRTPEVTCVEVKFNWYVDGVEVHNAKTKPREEQYVVS
VLTVLHQDWLNGKEYKCKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3agv Conformational plasticity of RNA for target recognition as revealed by the 2.15 A crystal structure of a human IgG-aptamer complex
Resolution2.15 Å
Binding residue
(original residue number in PDB)
K340 G341 Q342 R344 Y373 L398 G402
Binding residue
(residue number reindexed from 1)
K74 G75 Q76 R78 Y107 L132 G136
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3agv, PDBe:3agv, PDBj:3agv
PDBsum3agv
PubMed20675355
UniProtP01857|IGHG1_HUMAN Immunoglobulin heavy constant gamma 1 (Gene Name=IGHG1)

[Back to BioLiP]