Structure of PDB 3adl Chain A Binding Site BS01

Receptor Information
>3adl Chain A (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERF
IEIGSGTSKKLAKRNAAAKMLLRVHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3adl Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
Resolution2.2 Å
Binding residue
(original residue number in PDB)
A187 H188
Binding residue
(residue number reindexed from 1)
A36 H37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3adl, PDBe:3adl, PDBj:3adl
PDBsum3adl
PubMed20462493
UniProtQ15633|TRBP2_HUMAN RISC-loading complex subunit TARBP2 (Gene Name=TARBP2)

[Back to BioLiP]