Structure of PDB 3adc Chain A Binding Site BS01

Receptor Information

>3adc Chain A (length=246) Species: 243232 (Methanocaldococcus jannaschii DSM 2661)

HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKE
KYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYA
IIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLII
DTTKDIDFNEIAKKLIEKSKEIPKFYVLEENNNISDKIDKETRKIVSEYI
KSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY

Ligand information

>3adc Chain C (length=88)

ggccgccgccaccggggugguccccgggccggacgauccggcgcgccccg
aguggggcgcgggguucaauuccccgcggcggccgcca

<<<<<<<<<..<<<<<<....>>>>>><<<<<<...>>>>>><<<<<<<.
...>>>>>>><<<<.......>>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3adc Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): R40 W46 E48 E51 K55 Y78 Y79 N80 S81 M82 R84 I120 V124 M128 D133 K137 K138 Y139 K140 W141 K192 R195 S199 I202 K203 K209 I212 V216 R219 K220 K224 K227
• Binding residue (residue number reindexed from 1): R42 W48 E50 E53 K57 Y80 Y81 N82 S83 M84 R86 I122 V126 M130 D135 K139 K140 Y141 K142 W143 K190 R193 S197 I200 K201 K207 I210 V214 R217 K218 K222 K225

Enzymatic activity

• Enzyme Commision number: 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016773 phosphotransferase activity, alcohol group as acceptor
• GO:0043915 L-seryl-tRNA(Sec) kinase activity

Biological Process

• GO:0001717 conversion of seryl-tRNAsec to selenocys-tRNAsec
• GO:0002098 tRNA wobble uridine modification
• GO:0016310 phosphorylation

External links

• PDB: RCSB:3adc, PDBe:3adc, PDBj:3adc
• PDBsum: 3adc
• PubMed: 20705242
• UniProt: Q58933|PSTK_METJA L-seryl-tRNA(Sec) kinase (Gene Name=pstK)