Structure of PDB 3a9k Chain A Binding Site BS01

Receptor Information
>3a9k Chain A (length=76) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
EDGRTLSDYNIQRESTLHLVLRLRGG
Ligand information
>3a9k Chain C (length=29) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GAPWNCDSCTFLNHPALNRCEQCEMPRYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3a9k Structural basis for specific recognition of Lys 63-linked polyubiquitin chains by NZF domains of TAB2 and TAB3
Resolution1.4 Å
Binding residue
(original residue number in PDB)		L8 I44 G47 H68 V70
Binding residue
(residue number reindexed from 1)		L8 I44 G47 H68 V70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3a9k, PDBe:3a9k, PDBj:3a9k
PDBsum3a9k
PubMed19927120
UniProtP0CG50|UBC_MOUSE Polyubiquitin-C (Gene Name=Ubc)

[Back to BioLiP]